PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626963.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 333aa    MW: 37850.6 Da    PI: 6.3334
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626963.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.41.3e-12251302556
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                     +r+rr++kNRe+A rsR+R++a++ eLe +  +L++eN +Lkk +ee +k+ 
  XP_013626963.1 251 RRQRRMIKNRESAARSRARRQAYTVELELELNQLTEENLKLKKIVEENEKKR 302
                     79****************************************9999988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-9244310IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714249301IPR004827Basic-leucine zipper domain
PfamPF001702.0E-11251303IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.88E-9251300No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-11251302No hitNo description
PROSITE patternPS000360254269IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MPGLESETST FHVFNQDLQT QLQTYPQETA VEEHPPVGRQ NSIMSLTLDE IQMKSGKSFG  60
AMNMDELLAN MWMTVEENNG GGAGAQQDGE KPTIVPRQGS LSVPVPLCKK TVEEVWFEIQ  120
NGVQQPPPSS IAGQNPDEDN RRQQTLGEIT LEDFLVKAGV VQEPLKTTMK MSSSDFGYNP  180
EFGVGLHCQT QNNYGDNRTG YNENRPFYSG MGESSSCMTG KERSDQYLTG LNAFRIQKRI  240
IDGPPEILME RRQRRMIKNR ESAARSRARR QAYTVELELE LNQLTEENLK LKKIVEENEK  300
KRRQEVMNRS IQITKEKNGD KLRRIRRMAS AGW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626963.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
RefseqXP_013626964.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
RefseqXP_013626965.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
SwissprotQ8RYD60.0AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLA0A0D3BGT70.0A0A0D3BGT7_BRAOL; Uncharacterized protein
STRINGBra019436.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.11e-172bZIP family protein